PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P18070_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NAC
Protein Properties Length: 248aa    MW: 28443.6 Da    PI: 8.6928
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P18070_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.1e-4961311128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeelv +yLk+kveg k+el evi+ + +yk++Pw+Lp +v +   ew+fF++ d+ky++g+r+nrat+sgyWkatgk
  GSMUA_Achr3P18070_001   6 LPPGFRFHPTDEELVGYYLKRKVEGLKIEL-EVIPVISLYKFDPWELPGNVFSLLVEWFFFCSWDRKYPNGSRTNRATASGYWKATGK 92 
                            79****************************.99***************76666667******************************** PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            d+++ + + ++ gl+ktLvfy grap g++t W+mheyrl
  GSMUA_Achr3P18070_001  93 DRKIAC-EPSAFGLRKTLVFYLGRAPGGQRTVWIMHEYRL 131
                            ******.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-552153IPR003441NAC domain
PROSITE profilePS5100552.2576154IPR003441NAC domain
PfamPF023653.7E-287131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MNAMLLPPGF RFHPTDEELV GYYLKRKVEG LKIELEVIPV ISLYKFDPWE LPGNVFSLLV  60
EWFFFCSWDR KYPNGSRTNR ATASGYWKAT GKDRKIACEP SAFGLRKTLV FYLGRAPGGQ  120
RTVWIMHEYR LCEDLFHGSS NFLGAFCLCR VIKRSGNWLK RSSNRQEEPK AEKYPSNMFD  180
FNRKRNIDEI FNGTEESSSL DLFDRSSGSS VINSPEIARW VEPDPIITVP SVPDASKVST  240
ALLPLWVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-53115715171NAC domain-containing protein 19
3swm_B6e-53115715171NAC domain-containing protein 19
3swm_C6e-53115715171NAC domain-containing protein 19
3swm_D6e-53115715171NAC domain-containing protein 19
3swp_A6e-53115715171NAC domain-containing protein 19
3swp_B6e-53115715171NAC domain-containing protein 19
3swp_C6e-53115715171NAC domain-containing protein 19
3swp_D6e-53115715171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009393947.11e-169PREDICTED: NAC domain-containing protein 72-like isoform X1
SwissprotQ9FFI53e-60NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM0SFM30.0M0SFM3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P18070_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.14e-76NAC domain containing protein 71